Cordyceps militaris: CCM_03780 Help Entry CCM_03780         CDS       T03108                                  Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism cmt  Cordyceps militaris Pathway cmt04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:cmt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     CCM_03780  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:cmt03016]     CCM_03780    04121 Ubiquitin system [BR:cmt04121]     CCM_03780 Transfer RNA biogenesis [BR:cmt03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     CCM_03780 Ubiquitin system [BR:cmt04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    CCM_03780 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  18165803 NCBI-ProteinID:  XP_006668991 UniProt:  G3JGJ0 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAASTEQISLAVEFSGGLEMLFSDQRLHSLSLPARDKDGKPTTIAFLIEHLCQNVMNDTR KELFVLEDHLRPGILVLVNDADWELEGEEAYELKSGDNILFVSTLHGG NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcttccacggagcaaatctcattggcggtcgagttttctggcgggcttgagatg cttttctcagaccagagactccattcgctctctctgcccgcgcgggacaaggatgggaag cccaccaccattgccttcctgatcgagcatctctgccaaaacgtcatgaacgacaccaga aaagagctctttgtgctagaagaccacctacgcccaggcatcttggtcctcgtcaacgat gcagactgggagctcgagggcgaggaggcgtacgagctaaagagtggcgacaacatcctg tttgtctcgactctccatggtggataa

DBGET integrated database retrieval system