Cordyceps militaris: CCM_08540 Help Entry CCM_08540         CDS       T03108                                  Name (RefSeq) Oligosaccaryltransferase   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism cmt  Cordyceps militaris Pathway cmt00510   N-Glycan biosynthesis cmt00513   Various types of N-glycan biosynthesis cmt01100   Metabolic pathways cmt04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cmt00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     CCM_08540    00513 Various types of N-glycan biosynthesis     CCM_08540  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CCM_08540 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  18170547 NCBI-ProteinID:  XP_006673741 UniProt:  G3JRE6 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MISDNDLYTLAIFLGSAAMLLIILYHFLESGAAKTIREETNTLYISRATLGKAIINDSVG VLEQKTHARPHYTKI NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgatttccgacaacgatctctatactctcgccattttccttggatctgctgctatgctt ctcattatcttataccacttcctcgagagcggcgctgcgaaaacgatacgcgaagaaacg aacacattgtacattagccgggcgacgctgggaaaggccattataaatgatagcgtcggc gtcttggaacaaaagacacatgcacggccacattatacaaagatttga

DBGET integrated database retrieval system