Campylobacter mucosalis: CMCT_1567 Help Entry CMCT_1567         CDS       T06923                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cmuc  Campylobacter mucosalis Pathway cmuc01100   Metabolic pathways cmuc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cmuc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CMCT_1567 (acpP)    00074 Mycolic acid biosynthesis     CMCT_1567 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CMCT_1567 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 Ribosomal_L50 MDN1_4th Motif Other DBs NCBI-ProteinID:  QKF63677 LinkDB All DBs Position 1543253..1543486 Genome browser AA seq 77 aa AA seqDB search MAIFEDVRDVVVEQLSVEPNAVKLESKIIEDLGADSLDVVELVMALEEKFGIEIPDGEAE KLISISDVVTYIEKLGK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaatatttgaagatgttagagatgtagttgtggagcagctaagcgttgagccaaat gctgtgaaactagaatcaaaaatcattgaagacctaggcgctgatagccttgacgttgtt gagcttgttatggctcttgaagagaaatttggtattgaaattcctgatggtgaagcagaa aaacttataagcatttctgacgttgtaacttatatagaaaaacttggcaaataa

DBGET integrated database retrieval system