Cronobacter muytjensii: AFK63_01185 Help Entry AFK63_01185       CDS       T04067                                  Symbol hfq Name (GenBank) RNA-binding protein   KO K03666   host factor-I protein Organism cmw  Cronobacter muytjensii Pathway cmw02024   Quorum sensing cmw03018   RNA degradation Brite KEGG Orthology (KO) [BR:cmw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AFK63_01185 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AFK63_01185 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cmw03019]     AFK63_01185 (hfq)    03036 Chromosome and associated proteins [BR:cmw03036]     AFK63_01185 (hfq) Messenger RNA biogenesis [BR:cmw03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AFK63_01185 (hfq) Chromosome and associated proteins [BR:cmw03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AFK63_01185 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ALB69287 LinkDB All DBs Position 235639..235947 Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGSNNYHHSNNAQPSSAASQDSEDAE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccgttcctcaacgctctgcgtcgggaacgtgtt ccagtttctatttatttggtgaatggtattaagctgcaaggtcagattgaatcttttgat cagttcgtgatcctgttgaaaaacacggtcagccagatggtttacaagcacgcgatctcg accgtggtgccgtctcgtccggtttctcaccatagtaacaacgcgggtggcggttctaat aactaccatcacagcaacaacgcacagccatcttccgctgcctctcaggatagcgaagac gccgaataa

DBGET integrated database retrieval system