Cronobacter muytjensii: AFK63_11090 Help Entry AFK63_11090       CDS       T04067                                  Name (GenBank) damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism cmw  Cronobacter muytjensii Brite KEGG Orthology (KO) [BR:cmw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cmw03400]     AFK63_11090 DNA repair and recombination proteins [BR:cmw03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     AFK63_11090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI KH_PARP14_2 Cutinase Motif Other DBs NCBI-ProteinID:  ALB71133 LinkDB All DBs Position 2373192..2373437 Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTTPLPPGAIDALASELSRRIESHFPEMPNHVSVRYAAANQLSVLGGAKEDK DRISEILQETWESADDWFSAD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgaagtgactatcgccaaaaccacgccgttaccgccaggcgctatcgacgcg ctggccagcgagctatcccgccgtattgaaagccattttccggaaatgccgaaccacgtg agcgtgcgctatgccgctgcgaatcagttgtcggtactgggtggcgcgaaagaagataaa gatcgcatcagcgaaattctccaggaaacctgggagagcgctgacgactggttttctgct gattaa

DBGET integrated database retrieval system