Chelonia mydas (green sea turtle): 102930726 Help Entry 102930726         CDS       T02989                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy04810   Regulation of actin cytoskeleton cmy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmy00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102930726 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102930726 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmy04131]     102930726 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cmy04812]     102930726 (PFN3)    04147 Exosome [BR:cmy04147]     102930726 (PFN3) Membrane trafficking [BR:cmy04131]  Others   Actin-binding proteins    Others     102930726 (PFN3) Cytoskeleton proteins [BR:cmy04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102930726 (PFN3) Exosome [BR:cmy04147]  Exosomal proteins   Proteins found in most exosomes    102930726 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  102930726 NCBI-ProteinID:  XP_007064823 UniProt:  M7B001 LinkDB All DBs Position 3:156495361..156499157 Genome browser AA seq 137 aa AA seqDB search MGDWKSYINTILKDKNIEDVAIVGHSDNKSVWASKPGGLLAAISPQEVGVIIGHDRKGFL QTGITIAGKKCSVIRDYLLVEKDAVMDTRTKEGDSKSICIGKTPRALIFLMGKKGVHGGA LNKKVHEMIASMKAQNS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggtgactggaaaagctacatcaataccattctaaaggataagaacattgaagatgta gctatcgtggggcacagtgacaacaaatcagtatgggcttccaagccagggggcctactg gctgctatctcacctcaggaagtgggggtgatcataggccatgacaggaaggggttcctg cagacagggattaccatagctggcaagaagtgcagtgtgatccgtgactacttgcttgtg gaaaaagatgctgtgatggacaccagaaccaaggagggtgacagcaagtccatctgtatt ggcaagacccccagagccctgatcttcctcatgggcaaaaagggagtccatggaggagcc ctcaacaagaaggtgcatgagatgattgcaagcatgaaagcccagaatagctag

DBGET integrated database retrieval system