Chelonia mydas (green sea turtle): 102933404 Help Entry 102933404         CDS       T02989                                  Name (RefSeq) calmodulin-A   KO K02183   calmodulin Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy04020   Calcium signaling pathway cmy04070   Phosphatidylinositol signaling system cmy04114   Oocyte meiosis cmy04218   Cellular senescence cmy04261   Adrenergic signaling in cardiomyocytes cmy04270   Vascular smooth muscle contraction cmy04371   Apelin signaling pathway cmy04625   C-type lectin receptor signaling pathway cmy04744   Phototransduction cmy04910   Insulin signaling pathway cmy04912   GnRH signaling pathway cmy04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cmy00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     102933404    04020 Calcium signaling pathway     102933404    04070 Phosphatidylinositol signaling system     102933404  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102933404    04218 Cellular senescence     102933404  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102933404   09152 Endocrine system    04910 Insulin signaling pathway     102933404    04912 GnRH signaling pathway     102933404    04916 Melanogenesis     102933404   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102933404    04270 Vascular smooth muscle contraction     102933404   09157 Sensory system    04744 Phototransduction     102933404  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cmy01009]     102933404   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmy04131]     102933404    03036 Chromosome and associated proteins [BR:cmy03036]     102933404   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmy04147]     102933404 Protein phosphatases and associated proteins [BR:cmy01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102933404 Membrane trafficking [BR:cmy04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102933404 Chromosome and associated proteins [BR:cmy03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102933404 Exosome [BR:cmy04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102933404 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH EF-hand_11 EFhand_Ca_insen SPARC_Ca_bdg DUF1103 SPEF2_C DUF5580_M MecA_N Motif Other DBs NCBI-GeneID:  102933404 NCBI-ProteinID:  XP_037758293 LinkDB All DBs Position 1:341466389..341466838 Genome browser AA seq 149 aa AA seqDB search MAGQLAEEQIAEFKEAFSLFDKDGDGSITTSELGNVMQSLGQNPTEAELQDMIGELDTDG SGTVDFPEFLSLMARKMRDMDSEEEIREAFRVFDEDGIGYISAAELRHVMTNLGEKLTDE EVDEMIKEADADGNGQVNYEEFVRMMASK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccggccagctggcagaggagcagatcgcagagttcaaagaagccttctcgctcttt gacaaagatggtgatggatccatcaccaccagtgaactggggaatgtcatgcagtcgctg gggcagaaccccaccgaggccgagctgcaagacatgatcggcgagttggacaccgacggc agcggcacggtggacttccccgaattcctgtccttgatggcgaggaagatgagggacatg gacagcgaggaggagatccgggaagccttccgggtctttgacgaggatgggattggctac atcagcgcggcggagctccggcacgtcatgaccaacctcggtgagaagctgacggacgag gaggtggacgagatgatcaaggaggccgatgcagatggcaacgggcaagtcaactacgag gagtttgtgaggatgatggcctcaaagtga

DBGET integrated database retrieval system