Chelonia mydas (green sea turtle): 102936260 Help Entry 102936260         CDS       T02989                                  Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy00860   Porphyrin metabolism cmy04216   Ferroptosis cmy04217   Necroptosis Brite KEGG Orthology (KO) [BR:cmy00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     102936260  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     102936260    04217 Necroptosis     102936260  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmy04147]     102936260 Enzymes [BR:cmy01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      102936260 Exosome [BR:cmy04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102936260   Exosomal proteins of bladder cancer cells    102936260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Rubrerythrin Motif Other DBs NCBI-GeneID:  102936260 NCBI-ProteinID:  XP_007055290 UniProt:  M7BSC9 LinkDB All DBs Position 8:65459671..65460171 Genome browser AA seq 145 aa AA seqDB search MSSSPSQVRQNYNQDCEAAVNRQINLELYASYVYLSMSFYFDRDAVALKNFAKYFLHQSH EEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWENGLTAMECALHLEKNVNQSLLDLHKL ATDKNDPHLCDFIAKLLTLLFSHSN NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgtctccatcccaggtgcgccagaactacaaccaggactgcgaggcggccgtc aaccgccagatcaacctggagctctacgcctcctacgtgtacctcagcatgtctttctat tttgaccgggatgctgtggctctaaagaactttgccaagtatttcctgcaccagtcccac gaggagcgtgagcatgctgaaaaactcatgaagctgcagaaccagaggggcggtcgcatc tttttgcaggacatcaagaaaccagatcgtgatgattgggagaatgggttgacagcaatg gaatgtgccttgcacctggaaaagaatgtgaaccagtcactccttgatctgcacaagctg gcaactgacaagaatgaccctcatttgtgtgatttcattgccaagctcctgaccctcctc ttctcacactctaattaa

DBGET integrated database retrieval system