Chelonia mydas (green sea turtle): 102936769 Help Entry 102936769         CDS       T02989                                  Name (RefSeq) metallothionein   KO K14739   metallothionein 1/2 Organism cmy  Chelonia mydas (green sea turtle) Brite KEGG Orthology (KO) [BR:cmy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cmy03019]     102936769    03029 Mitochondrial biogenesis [BR:cmy03029]     102936769 Messenger RNA biogenesis [BR:cmy03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      102936769 Mitochondrial biogenesis [BR:cmy03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     102936769 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  102936769 NCBI-ProteinID:  XP_007070632 LinkDB All DBs Position 12:complement(7926625..7928803) Genome browser AA seq 63 aa AA seqDB search MDPQNCLCATGGSCTCADSCKCKNCRCTSCKKSCCSCCPAGCNNCAKGCVCKDAATSKCS CCS NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggatccccagaactgtctttgtgctaccggtggctcctgtacctgtgctgactcctgc aaatgcaagaattgcaggtgcacctcttgcaaaaagagttgttgctcctgttgcccagct ggatgcaataattgtgccaagggctgtgtctgcaaagatgcagcaaccagtaaatgcagc tgctgttcttaa

DBGET integrated database retrieval system