Chelonia mydas (green sea turtle): 102939543 Help Entry 102939543         CDS       T02989                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy03082   ATP-dependent chromatin remodeling cmy04217   Necroptosis Brite KEGG Orthology (KO) [BR:cmy00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102939543  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102939543  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cmy03036]     102939543   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmy04147]     102939543 Chromosome and associated proteins [BR:cmy03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102939543 Exosome [BR:cmy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102939543 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102939543 NCBI-ProteinID:  XP_007070172 UniProt:  M7BCS5 LinkDB All DBs Position 23:17716013..17716859 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKGK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgtggaaagcagggaggcaaagctcgggctaaggccaagtctcgctcttct cgtgcggggctgcagtttcccgtgggccgtgtgcatcggctcttgcgcaaggggaactat gcggagcgtgtgggcgccggcgctcccgtttacatggccgcggtgctggagtatctgact gctgaaatcttggagctggctggcaacgcggcccgggacaacaagaaaacccgcatcatc ccccgccacttgcagctggccatccgcaacgacgaggagttgaacaagctgctgggcaaa gtcaccattgcccagggtggggtcctgcccaacatccaggcggtgctgctgcccaagaaa accgagagccacaaagctaagggcaagtaa

DBGET integrated database retrieval system