Chelonia mydas (green sea turtle): 102939658 Help Entry 102939658         CDS       T02989                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy04081   Hormone signaling cmy04144   Endocytosis cmy04150   mTOR signaling pathway cmy04270   Vascular smooth muscle contraction cmy04310   Wnt signaling pathway cmy04350   TGF-beta signaling pathway cmy04510   Focal adhesion cmy04517   IgSF CAM signaling cmy04519   Cadherin signaling cmy04520   Adherens junction cmy04530   Tight junction cmy04621   NOD-like receptor signaling pathway cmy04625   C-type lectin receptor signaling pathway cmy04810   Regulation of actin cytoskeleton cmy05100   Bacterial invasion of epithelial cells cmy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmy00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102939658 (RHOA)    04350 TGF-beta signaling pathway     102939658 (RHOA)    04150 mTOR signaling pathway     102939658 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102939658 (RHOA)    04517 IgSF CAM signaling     102939658 (RHOA)    04519 Cadherin signaling     102939658 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102939658 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102939658 (RHOA)    04520 Adherens junction     102939658 (RHOA)    04530 Tight junction     102939658 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102939658 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102939658 (RHOA)    04625 C-type lectin receptor signaling pathway     102939658 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102939658 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102939658 (RHOA)    05100 Bacterial invasion of epithelial cells     102939658 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmy04131]     102939658 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmy04147]     102939658 (RHOA)    04031 GTP-binding proteins [BR:cmy04031]     102939658 (RHOA) Membrane trafficking [BR:cmy04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102939658 (RHOA) Exosome [BR:cmy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102939658 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102939658 (RHOA)   Exosomal proteins of colorectal cancer cells    102939658 (RHOA)   Exosomal proteins of bladder cancer cells    102939658 (RHOA) GTP-binding proteins [BR:cmy04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102939658 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU HCMV_UL15A Gtr1_RagA SRPRB Motif Other DBs NCBI-GeneID:  102939658 NCBI-ProteinID:  XP_007061831 LinkDB All DBs Position 7:50628888..50696047 Genome browser AA seq 270 aa AA seqDB search MGSVNSTRAFIAPLPSSPFANCADWLSWRRRACAVLSSCERARSAPPVAVRCCCSSGARR AGSGASEARLSRAGPAAMAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYV ADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEV KHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKT KDGVREVFEMATRAALQARRGKKKSGCLLL NT seq 813 nt NT seq  +upstreamnt  +downstreamnt atgggtagcgtaaatagcacccgggcttttatagcgccgcttcccagcagccctttcgcc aactgcgctgattggctcagctggcggcggcgcgcatgcgctgtgctgtcctcctgtgag cgcgcacgttctgccccgcctgttgccgttcgctgctgctgcagctcgggggcccgtaga gcaggaagcggcgcgagcgaggcgagactgagccgggccgggcctgcagctatggcagcc attcggaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgtctgctgatt gtatttagcaaagaccagttccctgaagtttatgttcccacagtgtttgaaaattatgta gcagatattgaagtggatggaaagcaggttgagttggccctgtgggatactgcaggacaa gaagattatgatcgacttaggcctctgtcatatccagacaccgatgttatacttatgtgt ttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggaccccagaggtg aaacatttctgccccaatgtgcctatcatactggtaggaaacaagaaggacttaagaaat gatgagcacacacgacgggagctggccaaaatgaagcaggagccggtcaaacctgaagaa ggcagagacatggcaaaccgcattggtgcattcgggtacatggagtgctctgcaaagacc aaagacggcgtgagggaggtttttgaaatggccactagagctgctttgcaagcccggcgt ggcaagaaaaaatctggctgccttctcttgtaa

DBGET integrated database retrieval system