Chelonia mydas (green sea turtle): 102939974 Help Entry 102939974         CDS       T02989                                  Name (RefSeq) histone H2A type 2-C-like   KO K11251   histone H2A Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy03082   ATP-dependent chromatin remodeling cmy04217   Necroptosis Brite KEGG Orthology (KO) [BR:cmy00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102939974  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102939974  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cmy03036]     102939974   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmy04147]     102939974 Chromosome and associated proteins [BR:cmy03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102939974 Exosome [BR:cmy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102939974 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102939974 NCBI-ProteinID:  XP_037744266 LinkDB All DBs Position 23:17723456..17724399 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKGK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgtggaaagcagggaggcaaagctcgggctaaggccaagtctcgctcttct cgtgcggggctgcagttccccgtaggccgcgtacaccggctcttgcgcaaggggaactat gcggagcgtgtgggcgccggcgctcccgtttacatggccgcggtgctggagtatctgact gctgaaatcttggagctggctggcaacgccgcccgggacaacaagaaaacccgcatcatc ccccgccacttgcagctggctatccgcaacgacgaggagctgaacaagctgttgggcaaa gtcaccatcgcccagggtggggtcctgcccaacatccaggcggtgctgctgcccaagaaa accgagagccacaaagccaagggcaagtga

DBGET integrated database retrieval system