Chelonia mydas (green sea turtle): 102940947 Help Entry 102940947         CDS       T02989                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy04810   Regulation of actin cytoskeleton cmy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmy00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102940947 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102940947 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmy04131]     102940947 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cmy04812]     102940947 (PFN2)    04147 Exosome [BR:cmy04147]     102940947 (PFN2) Membrane trafficking [BR:cmy04131]  Others   Actin-binding proteins    Others     102940947 (PFN2) Cytoskeleton proteins [BR:cmy04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102940947 (PFN2) Exosome [BR:cmy04147]  Exosomal proteins   Proteins found in most exosomes    102940947 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102940947 NCBI-ProteinID:  XP_037765229 LinkDB All DBs Position 9:27672082..27679292 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQNITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDSDYTMDIRTKSYGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaagtacgtctgggccgccacggccgggggcatcttc cagaacatcacgcccatagaaatagatatgattgtaggaaaagaccgagagggtttcttc accaacggtctgactcttggtgcaaagaagtgctctgtgatcagagatagcctgtatgtt gatagtgactacacaatggacatcaggacaaagagttatggtggcgagccaacatacaat gttgctgtaggcagagctggtcgagtcttggtctttgtaatgggcaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatatttgagagactctgggttc tag

DBGET integrated database retrieval system