Chelonia mydas (green sea turtle): 102945931 Help Entry 102945931         CDS       T02989                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy04068   FoxO signaling pathway cmy04136   Autophagy - other cmy04140   Autophagy - animal cmy04621   NOD-like receptor signaling pathway cmy04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:cmy00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     102945931 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102945931 (ATG12)    04136 Autophagy - other     102945931 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102945931 (ATG12)    04622 RIG-I-like receptor signaling pathway     102945931 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmy04131]     102945931 (ATG12)    04121 Ubiquitin system [BR:cmy04121]     102945931 (ATG12)    03029 Mitochondrial biogenesis [BR:cmy03029]     102945931 (ATG12) Membrane trafficking [BR:cmy04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     102945931 (ATG12) Ubiquitin system [BR:cmy04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    102945931 (ATG12) Mitochondrial biogenesis [BR:cmy03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     102945931 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  102945931 NCBI-ProteinID:  XP_037757506 LinkDB All DBs Position 5:complement(71837250..71842071) Genome browser AA seq 142 aa AA seqDB search MAEVEKQLPLSPQDGSRGECGEEPPNGGTAVGVAEPAPPSAGSPVTEEPAEDTKKKIDVL LKAVGDTPIMKNKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGT LYECFGSDGKLVLHYCKSQAWG NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggcggaagtggagaagcagctaccgctctctcctcaggatggtagccgaggcgagtgt ggagaagagcccccgaatgggggaactgcggtgggggttgccgagccggctcccccttca gccggctccccggtgaccgaggaacccgccgaggataccaagaagaaaattgacgtcctg ctgaaggctgtgggggacacgccgatcatgaagaacaagaagtgggccgtggagaggacc cgcaccatccaggggctcattgacttcatcaaaaagttcctcaagctggtggcctcggag cagctgtttatatatgtgaatcaatcctttgctccttctccagaccaggaagttgggaca ctctatgagtgttttggaagtgatggcaaacttgtactgcattactgcaaatctcaagcg tggggatga

DBGET integrated database retrieval system