Chelonia mydas (green sea turtle): 119564631 Help Entry 119564631         CDS       T02989                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy04810   Regulation of actin cytoskeleton cmy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmy00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     119564631 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119564631 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmy04131]     119564631 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cmy04812]     119564631 (PFN1)    04147 Exosome [BR:cmy04147]     119564631 (PFN1) Membrane trafficking [BR:cmy04131]  Others   Actin-binding proteins    Others     119564631 (PFN1) Cytoskeleton proteins [BR:cmy04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      119564631 (PFN1) Exosome [BR:cmy04147]  Exosomal proteins   Proteins found in most exosomes    119564631 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  119564631 NCBI-ProteinID:  XP_037743519 LinkDB All DBs Position 28:complement(926083..931905) Genome browser AA seq 140 aa AA seqDB search MSGWSCYIDRLMCDGNCQDAAIVGYKDTPCVWAATPGKTLCNITPAEVNTLIAKDRSGIF INGVTLGGMKCSVIRDNLFIEGEYTMDLRSKTTGEAPTYNITICMTNKAIVLAMGKEGVH GGCVNKQCFDMALHLRNLQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgagcggctggagctgctacatcgaccgcctcatgtgcgacggcaactgccaggacgcg gccatcgtgggctacaaggacaccccgtgcgtgtgggccgccaccccgggcaagacgctg tgcaacatcacgccggcagaggtgaacacgctgatcgccaaggaccgtagcggcatcttc atcaacggggtgacgctggggggcatgaagtgctcggtaatccgggacaacctgttcatc gagggggagtacaccatggacctgcggtccaagaccacgggcgaggcccccacctacaac attacaatctgcatgaccaacaaggcgatagtgctggccatgggcaaggagggcgttcac ggcggctgcgtgaacaagcaatgcttcgacatggcccttcacttgagaaacttgcagtat tga

DBGET integrated database retrieval system