Cupriavidus nantongensis: A2G96_12395 Help Entry A2G96_12395       CDS       T09823                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism cnan  Cupriavidus nantongensis Brite KEGG Orthology (KO) [BR:cnan00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cnan03036]     A2G96_12395    03400 DNA repair and recombination proteins [BR:cnan03400]     A2G96_12395 Chromosome and associated proteins [BR:cnan03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     A2G96_12395 DNA repair and recombination proteins [BR:cnan03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       A2G96_12395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AMR78471 UniProt:  A0A142JK59 LinkDB All DBs Position 1:2702171..2702377 Genome browser AA seq 68 aa AA seqDB search MQEYDLSIEDIAGKPSVEPAARAVPTKTKAAPPPRYRNPKTGQTWSGRGRAPAWLGKKPE RFLIDLLS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgcaggagtacgacctcagcattgaggacattgcgggcaagcccagtgttgagcccgct gcccgcgctgttccgaccaagacgaaggccgcgccgcctccgaggtaccgcaaccccaag acgggccagacctggtcggggcgcggccgggctcccgcgtggcttggcaagaagcccgag cgtttcctcatcgatctcttgtcctga

DBGET integrated database retrieval system