Cryptococcus deneoformans B-3501A: CNBA7900 Help Entry CNBA7900          CDS       T01040                                  Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism cnb  Cryptococcus deneoformans B-3501A Pathway cnb03083   Polycomb repressive complex cnb04111   Cell cycle - yeast cnb04120   Ubiquitin mediated proteolysis cnb04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cnb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CNBA7900    04120 Ubiquitin mediated proteolysis     CNBA7900   09126 Chromosome    03083 Polycomb repressive complex     CNBA7900  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     CNBA7900  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cnb04131]     CNBA7900    04121 Ubiquitin system [BR:cnb04121]     CNBA7900    03036 Chromosome and associated proteins [BR:cnb03036]     CNBA7900 Membrane trafficking [BR:cnb04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     CNBA7900 Ubiquitin system [BR:cnb04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      CNBA7900    Cul7 complex      CNBA7900 Chromosome and associated proteins [BR:cnb03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      CNBA7900   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      CNBA7900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  4934057 NCBI-ProteinID:  XP_777670 LinkDB All DBs Position 1:complement(2217307..2218378) Genome browser AA seq 167 aa AA seqDB search MAEKKQTVILTTSDDEQFTVEKIVAERSAMIKSMMEDLGDQEGQPIPLPNVSSSVLTKIL EYCDHHKNDPLPTGDANDADDSRRKTSEIGDWDARWIQVDQEMLFEIILAANYLDIKPLL DVGCKTVANMIKGKTPEEIRKLFNITNDFTPEEEEQIRKENEWAEDR NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggccgagaagaagcagaccgttatcctcaccacttctgacgatgagcaattcaccgtt gagaagattgtcgctgaacgatccgccatgattaaatctatgatggaggaccttggtgac caggagggtcagcccattccgctccccaacgtctcttcttccgtccttaccaagatcctg gagtactgcgaccaccacaagaacgaccctctccccaccggtgacgccaacgacgctgat gactctagaagaaagacttctgagattggtgactgggatgctcgatggatccaagttgac caagagatgctctttgagatcatccttgctgccaactacctcgacatcaagcctctcctc gatgttggctgcaagaccgttgccaacatgatcaagggtaagactcctgaagagatccga aagctcttcaacatcaccaacgacttcactcctgaggaggaagagcagatacgaaaggag aacgaatgggctgaggaccgttaa

DBGET integrated database retrieval system