Cryptococcus deneoformans B-3501A: CNBC2200 Help Entry CNBC2200          CDS       T01040                                  Name (RefSeq) hypothetical protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cnb  Cryptococcus deneoformans B-3501A Pathway cnb04145   Phagosome cnb04148   Efferocytosis cnb04620   Toll-like receptor signaling pathway cnb05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cnb00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CNBC2200    04148 Efferocytosis     CNBC2200  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     CNBC2200  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     CNBC2200  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cnb04131]     CNBC2200   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cnb04147]     CNBC2200    04031 GTP-binding proteins [BR:cnb04031]     CNBC2200 Membrane trafficking [BR:cnb04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     CNBC2200  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     CNBC2200   Macropinocytosis    Ras GTPases     CNBC2200  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     CNBC2200 Exosome [BR:cnb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CNBC2200   Exosomal proteins of other body fluids (saliva and urine)    CNBC2200   Exosomal proteins of colorectal cancer cells    CNBC2200   Exosomal proteins of bladder cancer cells    CNBC2200 GTP-binding proteins [BR:cnb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     CNBC2200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Glyco_hydro_72 Motif Other DBs NCBI-GeneID:  4934885 NCBI-ProteinID:  XP_776729 LinkDB All DBs Position 3:complement(610105..611260) Genome browser AA seq 198 aa AA seqDB search MATTRNIKCVVVGDGAVGKTCLLISYTTNAFPGEYVPTVFDNYSSQVIVDGMTVSLGLWD TAGQEDYDRLRPLSYPQTDVFLLCFSVVSPASFENVRTKWYPEIQHHSPGTPIILVGTKL DLRDDPMQIEKLRERRQAPIGYSQGSSMANDIKAAKYLECSALTQKNLKSVFDEAIRTVL NPNRRAGKAKKSSGCLVM NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggctactactagaaacatcaagtgtgttgtcgttggcgacggtgccgttggaaagaca tgtcttcttatcagttacacaaccaatgctttcccgggagaatatgtcccaacagttttt gacaactactcgagccaggtgattgtagatggtatgacggtatctttgggactgtgggat acagccggtcaagaagattacgaccgtcttcgacctttatcctacccgcagactgatgtc ttccttctctgcttttccgtcgtctcccctgcttcctttgaaaacgtccgaaccaaatgg tatcctgaaattcagcaccattcaccaggaactcctatcatccttgtcggtaccaagctc gatttgagagacgaccctatgcagattgaaaaactgagggaacgaaggcaagcgcccatt ggatattctcaaggctcatctatggcgaatgacatcaaggctgccaagtacctcgaatgc tcggctttgacgcagaagaacctcaagtctgtttttgacgaggctatccggacggtcctc aaccctaatcgacgagcgggcaaggcgaagaagagcagcggatgtcttgtcatgtaa

DBGET integrated database retrieval system