Cryptococcus deneoformans B-3501A: CNBF4550 Help Entry CNBF4550          CDS       T01040                                  Name (RefSeq) hypothetical protein   KO K04393   cell division control protein 42 Organism cnb  Cryptococcus deneoformans B-3501A Pathway cnb04011   MAPK signaling pathway - yeast cnb04144   Endocytosis cnb04517   IgSF CAM signaling cnb04518   Integrin signaling cnb05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cnb00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     CNBF4550   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     CNBF4550    04518 Integrin signaling     CNBF4550  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     CNBF4550  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     CNBF4550  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cnb04131]     CNBF4550    03036 Chromosome and associated proteins [BR:cnb03036]     CNBF4550   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cnb04147]     CNBF4550    04031 GTP-binding proteins [BR:cnb04031]     CNBF4550 Membrane trafficking [BR:cnb04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     CNBF4550  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     CNBF4550   Macropinocytosis    Ras GTPases     CNBF4550 Chromosome and associated proteins [BR:cnb03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     CNBF4550 Exosome [BR:cnb04147]  Exosomal proteins   Exosomal proteins of microglial cells    CNBF4550   Exosomal proteins of breast milk    CNBF4550 GTP-binding proteins [BR:cnb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     CNBF4550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  4937007 NCBI-ProteinID:  XP_774776 LinkDB All DBs Position 6:<1356469..>1357219 Genome browser AA seq 199 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDSPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLICFSIASPASFENVREKWFHEISHHCPGAPCLIVGTQVDLR DDPKQVERMMSGSGRGGGGGRGGLITQEQGERLARELGGRKYVECSALTQKGLKNVFDEA IVAALEPPVVKKTKKCLIL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atgcagactatcaaatgcgtcgtcgtgggtgacggcgctgtcggaaagacatgtctgttg atatcctatacaacaaacaagtttccatcggaatatgtgcctacggtgtttgacaactat gcggtgactgtcatgattggtgatagcccttacacactcggtttattcgacacggccggg caggaagactacgaccggctgcgcccgctatcttacccgcagacagacgtcttcctcatc tgcttctcgatcgcttcccccgcttcgtttgagaatgtgcgtgaaaaatggtttcacgaa atctcgcatcattgccccggggcgccgtgcttgatagtggggacgcaggtcgatttgcgg gatgatccaaagcaggtggagaggatgatgagtggtagtggccggggagggggagggggg aggggcgggttgataacgcaagagcaaggggagcggctggcgagagagttgggcgggaga aagtatgtagagtgttcggcgttgacgcagaaagggttgaagaatgtgtttgatgaggca atcgtagcggctcttgaaccgccagtggtgaaaaagacgaaaaagtgcttgatcctctaa

DBGET integrated database retrieval system