Cryptococcus deneoformans B-3501A: CNBM0090 Help Entry CNBM0090          CDS       T01040                                  Name (RefSeq) hypothetical protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cnb  Cryptococcus deneoformans B-3501A Pathway cnb04145   Phagosome cnb04148   Efferocytosis cnb04620   Toll-like receptor signaling pathway cnb05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cnb00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CNBM0090    04148 Efferocytosis     CNBM0090  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     CNBM0090  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     CNBM0090  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cnb04131]     CNBM0090   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cnb04147]     CNBM0090    04031 GTP-binding proteins [BR:cnb04031]     CNBM0090 Membrane trafficking [BR:cnb04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     CNBM0090  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     CNBM0090   Macropinocytosis    Ras GTPases     CNBM0090  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     CNBM0090 Exosome [BR:cnb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CNBM0090   Exosomal proteins of other body fluids (saliva and urine)    CNBM0090   Exosomal proteins of colorectal cancer cells    CNBM0090   Exosomal proteins of bladder cancer cells    CNBM0090 GTP-binding proteins [BR:cnb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     CNBM0090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  4939361 NCBI-ProteinID:  XP_772272 LinkDB All DBs Position 13:21223..22372 Genome browser AA seq 198 aa AA seqDB search MAMQSIKCVVVGDGAVGKTCLLISYTTNSFPGEYVPTVFDNYSASVLVDGRPVSLGLWDT AGQEDYDRLRPLSYPQTDVFLVCFSIVSPPSFENVKTWIPEIRHHAPTTPILLIGTKLDL RDDPVTLSRLKERRFQPIGFEMGVRCAREIGAVRYLEASSRTQKGLKNVFDEAIRAVLSP STRDAREKKKKKQQCLIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggccatgcagagtatcaaatgcgtcgtcgtcggtgacggcgccgtcggaaagacatgt ctcttgatttcatacaccaccaactcattccccggggaatacgtcccgactgtgtttgac aactactctgccagcgtactcgttgatggtcggccggtcagtctgggattatgggatact gccgggcaggaagactatgaccggctaagaccactatcctacccacagaccgatgtattc ctcgtctgcttctcaatcgtctctccaccaagtttcgaaaatgtcaaaacgtggatcccc gaaatccgccaccacgctccaacgactcccatccttctcatcggcaccaaactcgatctc cgggacgaccccgtcaccctctcacggctgaaagaacgccgtttccaaccgatcgggttt gagatgggtgtcagatgcgcgagggagattggggctgttaggtatttggaggcttccagt cggacacaaaaaggcttgaaaaacgtattcgacgaagcgatccgtgcggtactcagtcct tctacaagggacgcgagggagaagaagaagaagaaacagcagtgtttgattctctga

DBGET integrated database retrieval system