Cupriavidus necator N-1: CNE_1c03500 Help Entry CNE_1c03500       CDS       T01564                                  Name (GenBank) glutaredoxin-like protein   KO K03676   glutaredoxin 3 Organism cnc  Cupriavidus necator N-1 Brite KEGG Orthology (KO) [BR:cnc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cnc03110]     CNE_1c03500 Chaperones and folding catalysts [BR:cnc03110]  Protein folding catalysts   Protein disulfide isomerase    CNE_1c03500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like DSBA Motif Other DBs NCBI-ProteinID:  AEI75716 UniProt:  G0EUK5 LinkDB All DBs Position 1:347921..348178 Genome browser AA seq 85 aa AA seqDB search MARVVMYSTVVCPYCLMAERLLKSKGVEMIEKILIDREPGKREEMMARTGRRTVPQIYID ETHVGGFDDLSALDRQGGLVPLLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcccgtgtcgtcatgtacagcaccgttgtgtgcccgtattgcctgatggctgaacgc ctgctcaagtccaagggcgtggaaatgatcgagaagatcctgatcgaccgcgaacccggc aagcgtgaagagatgatggcccgtactggtcgccgcaccgtgccgcagatctacatcgac gagacccacgtgggcggcttcgacgacctctcggcgctggaccgccagggcggcctggtg ccgctgctggctgcctga

DBGET integrated database retrieval system