Cupriavidus necator N-1: CNE_2c22260 Help Entry CNE_2c22260       CDS       T01564                                  Name (GenBank) H-NS-like DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism cnc  Cupriavidus necator N-1 Brite KEGG Orthology (KO) [BR:cnc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cnc03036]     CNE_2c22260    03400 DNA repair and recombination proteins [BR:cnc03400]     CNE_2c22260 Chromosome and associated proteins [BR:cnc03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     CNE_2c22260 DNA repair and recombination proteins [BR:cnc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       CNE_2c22260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS PRF Histone_HNS_N YL1_C Motif Other DBs NCBI-ProteinID:  AEI81175 UniProt:  F8GTC9 LinkDB All DBs Position 2:2406913..2407221 Genome browser AA seq 102 aa AA seqDB search MATYKQLLAEKEALEAKLNEVRATEVAGVIDKIRDLMTEYGLTVEDILPRRKRGRPAGSS AKKPASALPPKYMDPKTGKTWSGRGRAPAWLGKRPERFLIEQ NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggcgacatacaagcaactcctggctgagaaggaagcgctggaagccaagctgaatgaa gtgcgtgcgacggaagtcgccggcgtaatcgacaaaatccgggacctgatgactgaatac ggcctgaccgtcgaagacatcctgccccgccgcaagcgtggccgcccggctggttcgagc gccaagaagcctgcatccgctttgccgccgaagtacatggaccccaagaccggcaagacc tggtcgggccgcggccgtgcgccggcatggctgggcaagcgcccggagcgtttcctgatc gagcagtaa

DBGET integrated database retrieval system