Cupriavidus necator N-1: CNE_BB1p02400 Help Entry CNE_BB1p02400     CDS       T01564                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism cnc  Cupriavidus necator N-1 Brite KEGG Orthology (KO) [BR:cnc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cnc03036]     CNE_BB1p02400    03400 DNA repair and recombination proteins [BR:cnc03400]     CNE_BB1p02400 Chromosome and associated proteins [BR:cnc03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     CNE_BB1p02400 DNA repair and recombination proteins [BR:cnc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       CNE_BB1p02400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AEI81664 UniProt:  F8GW89 LinkDB All DBs Position BB1p:233172..233462 Genome browser AA seq 96 aa AA seqDB search MTAKIERAAAVRWIQDRMADYDLTMEKLRAAGCFDRPPPTTAAGAGAARTPASAASAAAG GLLPQRRGPSWDGAGEMPDWLRRAVNAGQSAEFYRV NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgacagcaaaaattgagcgggcggcggcggtccgctggatccaggaccggatggccgac tacgacctgaccatggagaaactgcgggcggcagggtgctttgatcggccgcccccaacc accgccgctggcgccggtgccgcccgcacccccgccagcgccgccagcgccgccgccggt ggtctgttaccgcaacgccgcgggccgagctgggacggggccggcgagatgccggactgg ctgcggcgggcggtcaatgcggggcagagcgcggagttttaccgggtataa

DBGET integrated database retrieval system