Cryptococcus deneoformans JEC21: CNF01140
Help
Entry
CNF01140 CDS
T00243
Name
(RefSeq) hypothetical protein
KO
K27383
non-classical export protein 1
Organism
cne
Cryptococcus deneoformans JEC21
Brite
KEGG Orthology (KO) [BR:
cne00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
cne02000
]
CNF01140
Transporters [BR:
cne02000
]
Other transporters
Others
CNF01140
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
NCE101
Motif
Other DBs
NCBI-GeneID:
3258432
NCBI-ProteinID:
XP_024513005
UniProt:
Q5KFN6
LinkDB
All DBs
Position
6:348061..348318
Genome browser
AA seq
85 aa
AA seq
DB search
MTKVYLLSRTLDPLLAVFTGLFAFHLNQNNPRTAPPPGHTLQELLKWKWAESKKIREARD
KEASEEWENVTRELVGETSVEEAKR
NT seq
258 nt
NT seq
+upstream
nt +downstream
nt
atgaccaaggtgtacctcctctcacgcacacttgaccctcttctcgccgttttcaccggt
ctcttcgcctttcacctcaaccagaacaatccccggacagcgcctcctcccggccacaca
ttgcaagagcttctgaaatggaagtgggcagaatctaagaagattagggaggctagggat
aaggaggcatcggaagaatgggagaatgtgacgagggagcttgtgggagaaacttctgtc
gaggaggctaagagatga
DBGET
integrated database retrieval system