Chryseobacterium nakagawai: EG343_08920 Help Entry EG343_08920       CDS       T06300                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism cnk  Chryseobacterium nakagawai Brite KEGG Orthology (KO) [BR:cnk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cnk03032]     EG343_08920    03036 Chromosome and associated proteins [BR:cnk03036]     EG343_08920    03400 DNA repair and recombination proteins [BR:cnk03400]     EG343_08920 DNA replication proteins [BR:cnk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EG343_08920 Chromosome and associated proteins [BR:cnk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EG343_08920 DNA repair and recombination proteins [BR:cnk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EG343_08920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AZA90739 UniProt:  A0AAD1DRC7 LinkDB All DBs Position 1986890..1987180 Genome browser AA seq 96 aa AA seqDB search MNKSELIDAIAKDAGITKVAAKAALESFIGNVTSTLKKKDGKVSLVGFGTFSVAERAARQ GINPATKKPIKIAAKKVAKFKAGADLSNAVSGAKKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtctgaattaatcgacgcaatcgcaaaagatgcaggtatcactaaagttgca gcaaaggctgctttagaatctttcattggtaacgtaacttctactttaaagaaaaaagac ggaaaagtttctttagtaggtttcggtactttctcagtagctgagagagcagctagacaa gggattaaccctgcaactaagaaaccaatcaaaattgctgctaaaaaagttgctaaattc aaggctggagctgatttatcaaatgcagtttctggtgctaagaaaaaataa

DBGET integrated database retrieval system