KEGG   Chionomys nivalis (European snow vole): 130873132
Entry
130873132         CDS       T11437                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
cnl  Chionomys nivalis (European snow vole)
Pathway
cnl04014  Ras signaling pathway
cnl04015  Rap1 signaling pathway
cnl04020  Calcium signaling pathway
cnl04022  cGMP-PKG signaling pathway
cnl04024  cAMP signaling pathway
cnl04070  Phosphatidylinositol signaling system
cnl04114  Oocyte meiosis
cnl04218  Cellular senescence
cnl04261  Adrenergic signaling in cardiomyocytes
cnl04270  Vascular smooth muscle contraction
cnl04371  Apelin signaling pathway
cnl04625  C-type lectin receptor signaling pathway
cnl04713  Circadian entrainment
cnl04720  Long-term potentiation
cnl04722  Neurotrophin signaling pathway
cnl04728  Dopaminergic synapse
cnl04740  Olfactory transduction
cnl04744  Phototransduction
cnl04750  Inflammatory mediator regulation of TRP channels
cnl04910  Insulin signaling pathway
cnl04912  GnRH signaling pathway
cnl04915  Estrogen signaling pathway
cnl04916  Melanogenesis
cnl04921  Oxytocin signaling pathway
cnl04922  Glucagon signaling pathway
cnl04924  Renin secretion
cnl04925  Aldosterone synthesis and secretion
cnl04970  Salivary secretion
cnl04971  Gastric acid secretion
cnl05010  Alzheimer disease
cnl05012  Parkinson disease
cnl05022  Pathways of neurodegeneration - multiple diseases
cnl05031  Amphetamine addiction
cnl05034  Alcoholism
cnl05133  Pertussis
cnl05152  Tuberculosis
cnl05163  Human cytomegalovirus infection
cnl05167  Kaposi sarcoma-associated herpesvirus infection
cnl05170  Human immunodeficiency virus 1 infection
cnl05200  Pathways in cancer
cnl05214  Glioma
cnl05417  Lipid and atherosclerosis
cnl05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cnl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    130873132
   04015 Rap1 signaling pathway
    130873132
   04371 Apelin signaling pathway
    130873132
   04020 Calcium signaling pathway
    130873132
   04070 Phosphatidylinositol signaling system
    130873132
   04024 cAMP signaling pathway
    130873132
   04022 cGMP-PKG signaling pathway
    130873132
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    130873132
   04218 Cellular senescence
    130873132
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    130873132
  09152 Endocrine system
   04910 Insulin signaling pathway
    130873132
   04922 Glucagon signaling pathway
    130873132
   04912 GnRH signaling pathway
    130873132
   04915 Estrogen signaling pathway
    130873132
   04921 Oxytocin signaling pathway
    130873132
   04916 Melanogenesis
    130873132
   04924 Renin secretion
    130873132
   04925 Aldosterone synthesis and secretion
    130873132
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    130873132
   04270 Vascular smooth muscle contraction
    130873132
  09154 Digestive system
   04970 Salivary secretion
    130873132
   04971 Gastric acid secretion
    130873132
  09156 Nervous system
   04728 Dopaminergic synapse
    130873132
   04720 Long-term potentiation
    130873132
   04722 Neurotrophin signaling pathway
    130873132
  09157 Sensory system
   04744 Phototransduction
    130873132
   04740 Olfactory transduction
    130873132
   04750 Inflammatory mediator regulation of TRP channels
    130873132
  09159 Environmental adaptation
   04713 Circadian entrainment
    130873132
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    130873132
  09162 Cancer: specific types
   05214 Glioma
    130873132
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    130873132
   05163 Human cytomegalovirus infection
    130873132
   05167 Kaposi sarcoma-associated herpesvirus infection
    130873132
  09171 Infectious disease: bacterial
   05133 Pertussis
    130873132
   05152 Tuberculosis
    130873132
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    130873132
   05012 Parkinson disease
    130873132
   05022 Pathways of neurodegeneration - multiple diseases
    130873132
  09165 Substance dependence
   05031 Amphetamine addiction
    130873132
   05034 Alcoholism
    130873132
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    130873132
   05418 Fluid shear stress and atherosclerosis
    130873132
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cnl01009]
    130873132
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cnl04131]
    130873132
   03036 Chromosome and associated proteins [BR:cnl03036]
    130873132
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cnl04147]
    130873132
Protein phosphatases and associated proteins [BR:cnl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     130873132
Membrane trafficking [BR:cnl04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    130873132
Chromosome and associated proteins [BR:cnl03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     130873132
Exosome [BR:cnl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   130873132
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF_EFCAB10_C EF-hand_FSTL1 UPF0154 EH SPARC_Ca_bdg Allatotropin-like_C EF-hand_11 TerB EF-hand_EFHB_C DUF1103 FCaBP_EF-hand DUF5580_M SAPC2_N Dockerin_1 EFhand_Ca_insen SPEF2_C SurA_N_3 DUF2267
Other DBs
NCBI-GeneID: 130873132
NCBI-ProteinID: XP_057623683
LinkDB
Position
4:complement(23181852..23183234)
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKQLGTVMRSLGQNPTEAELQDMINEVDADG
NDTIDFPEFLTMMARKMKDTESEEEIHEVFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADIYGDGQVNYEEFVQMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgatcagctgactgaagaacagattgctgaattcaaggaagctttctccctgttt
gacaaagatggtgatggcaccatcacaacaaagcaacttgggactgtcatgaggtcactg
ggtcagaacccaacagaagctgaattgcaggacatgatcaacgaagtggatgctgacggg
aatgacaccattgacttcccagagttcttgaccatgatggctagaaaaatgaaagataca
gagagcgaagaagaaatccatgaggtattccgagtctttgacaaggatggaaatggttac
atcagcgcagcagaattgcgccacgtcatgacaaacttaggagagaagctaacggatgaa
gaagtagatgagatgatcagagaagcagatatctatggagatggacaagtcaactatgaa
gaattcgtacagatgatgactgcaaaatga

DBGET integrated database retrieval system