Contarinia nasturtii (swede midge): 116338566 Help Entry 116338566         CDS       T08003                                  Name (RefSeq) dynein light chain Tctex-type   KO K10420   dynein light chain Tctex-type 1/3 Organism cns  Contarinia nasturtii (swede midge) Pathway cns04814   Motor proteins Brite KEGG Orthology (KO) [BR:cns00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     116338566  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cns03037]     116338566    04812 Cytoskeleton proteins [BR:cns04812]     116338566 Cilium and associated proteins [BR:cns03037]  Motile cilia and associated proteins   Dynein arm    116338566 Cytoskeleton proteins [BR:cns04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      116338566 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 UDI Motif Other DBs NCBI-GeneID:  116338566 NCBI-ProteinID:  XP_031619779 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MIDDIKDENQFVVDDVSKIIKEAIENTIGGNAYQHDKVNHWTKTVVDNCLAVLTKLQKPY KYIVTCMIMQKNGAGLHTASSCYWNNETDGSCTVRWENKTMYCIVSVFGLAI NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgattgatgacattaaagatgagaatcaattcgtcgtcgacgatgtgagtaaaataatt aaagaagctatcgaaaacacaattggtggtaacgcatatcaacatgacaaagtgaatcat tggaccaaaacggtggttgacaattgtctcgctgtcttgacaaaacttcaaaaaccatac aaatacattgtaacttgcatgattatgcaaaagaatggtgccggtttgcatacagctagc tcatgttattggaacaatgaaacggacggttcgtgtacggttcgttgggagaataagaca atgtattgcatagtatctgtctttggtttggccatttaa

DBGET integrated database retrieval system