Contarinia nasturtii (swede midge): 116339007 Help Entry 116339007         CDS       T08003                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism cns  Contarinia nasturtii (swede midge) Pathway cns04137   Mitophagy - animal cns04140   Autophagy - animal cns04144   Endocytosis cns04145   Phagosome cns04148   Efferocytosis Brite KEGG Orthology (KO) [BR:cns00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116339007    04145 Phagosome     116339007    04140 Autophagy - animal     116339007    04137 Mitophagy - animal     116339007    04148 Efferocytosis     116339007  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cns04131]     116339007   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cns04147]     116339007    04031 GTP-binding proteins [BR:cns04031]     116339007 Membrane trafficking [BR:cns04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     116339007 Exosome [BR:cns04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116339007   Exosomal proteins of other body fluids (saliva and urine)    116339007   Exosomal proteins of colorectal cancer cells    116339007   Exosomal proteins of bladder cancer cells    116339007 GTP-binding proteins [BR:cns04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     116339007 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 nSTAND3 cobW AAA_22 AAA_16 Septin AAA_5 AAA_24 AAA_7 NTPase_1 PduV-EutP ATPase_2 NACHT SRPRB ABC_tran NB-ARC DAP3 AAA_14 Motif Other DBs NCBI-GeneID:  116339007 NCBI-ProteinID:  XP_031620463 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MASRKKVLLKVIILGESGVGKTSLMNQYVNKRFSNQYKATIGADFLTKEVVVDDRVVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKNLDSWRDEFLIQASPRDPEHFPF VVLGNKVDLENRSVSSKRAGQWCQSQNDIPYFETSAKEGINVERAFQTIAKNALAQESED GFNDFPPGIQLESNQNNRPRNSDNCPC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggccagcagaaagaaagtacttcttaaagtcatcattcttggcgaaagtggtgttggc aaaacgtcgctcatgaaccaatatgtgaataaacgattttcgaatcaatacaaagccacg attggagctgactttttgacaaaggaggtggtagtcgatgatcgtgttgttactatgcag atttgggatactgctggtcaagaacgatttcaatcgttaggtgttgcattttatcgcgga gccgattgttgtgtacttgtatttgatgtgactgcaccaaatacattcaagaatttagac tcatggcgtgacgaattcttgatccaggccagtccacgtgatccggaacacttcccattc gttgttcttggcaataaagttgacttggaaaaccgatcggtgtctagcaaacgggctgga cagtggtgtcaatctcaaaatgatattccctacttcgaaacatcagctaaagaaggtatc aatgtcgaacgtgctttccaaacgattgccaaaaatgcattagctcaagagagtgaggat ggtttcaacgattttccaccgggaattcaactggaatcgaaccaaaacaatcggcccaga aattcagacaactgtccatgctaa

DBGET integrated database retrieval system