Cedecea neteri SSMD04: JT31_04300 Help Entry JT31_04300        CDS       T03298                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cnt  Cedecea neteri SSMD04 Pathway cnt01100   Metabolic pathways cnt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cnt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JT31_04300    00074 Mycolic acid biosynthesis     JT31_04300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JT31_04300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH TerB Motif Other DBs NCBI-ProteinID:  AIR03856 UniProt:  A0A089UFT7 LinkDB All DBs Position complement(939465..939701) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNTASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattggcgaacaactgggcgttaagcaa gaagaagtagtgaacaccgcttccttcgttgaggacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcactaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system