KEGG   Caldicellulosiruptor obsidiansis: COB47_0855
Entry
COB47_0855        CDS       T01293                                 
Name
(GenBank) ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cob00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    COB47_0855
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cob03011]
    COB47_0855
Ribosome [BR:cob03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    COB47_0855
  Bacteria
    COB47_0855
  Archaea
    COB47_0855
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-ProteinID: ADL42164
UniProt: D9TJI2
LinkDB
Position
981059..981427
AA seq 122 aa
MYKKVNRNEKRLIRHKRIRKKVFGTSDRPRLCVYKSLKYIYAQIIDDEKGHTLVAASSLE
PEIKSRLSSTKSIEAAEYVGKVIAERAKEKGITKVVFDRGGYPYHGRVKALAEAARQAGL
EF
NT seq 369 nt   +upstreamnt  +downstreamnt
ttgtataaaaaggtgaatagaaatgaaaagaggcttataagacacaaaagaattagaaaa
aaagtttttggtacaagtgatagacctcgtctttgcgtttacaagagtttaaaatatatt
tatgctcagataattgatgatgaaaaaggtcacacacttgttgctgcatcatcgcttgag
cctgagatcaagtcaagactgtcttcaacaaaatctatcgaggcagcagagtatgtaggg
aaagtaatagctgaaagggcaaaagaaaagggaataacaaaggttgtatttgatagaggc
ggttatccatatcatggaagagtaaaagcgcttgcggaagctgcaaggcaagccggtctt
gagttttaa

DBGET integrated database retrieval system