Cobetia sp. D5: U0O11_13590 Help Entry U0O11_13590       CDS       T10202                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cobd  Cobetia sp. D5 Pathway cobd01100   Metabolic pathways cobd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cobd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U0O11_13590    00074 Mycolic acid biosynthesis     U0O11_13590   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U0O11_13590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  WVS97897 LinkDB All DBs Position 3255707..3255979 Genome browser AA seq 90 aa AA seqDB search MSAEQQTASREEIYAHVRSTLIELFEIDAADIHPEALLYEDLDIDSIDAVDLVVELKKFT GRRIEANDFKSVRSLDDVVTAVEQLMQRQA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgagcgctgagcaacagaccgcgtcccgcgaagagatctatgcccatgtgcgcagcacc ctgatcgagctgttcgagatcgatgccgctgacatccaccccgaggcgctgctctatgaa gacctcgacatcgacagcatcgatgcggtggacctggtggtcgaactcaagaagttcacc ggccgacgcatcgaagccaatgacttcaagagcgtacgcagcctcgatgacgtcgtgacc gccgtcgagcagctgatgcagcgccaggcatga

DBGET integrated database retrieval system