Cobetia sp. AM6: CLAM6_08930 Help Entry CLAM6_08930       CDS       T08724                                  Symbol acpP1 Name (GenBank) acyl carrier protein 1   KO K02078   acyl carrier protein Organism cobe  Cobetia sp. AM6 Pathway cobe01100   Metabolic pathways cobe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cobe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLAM6_08930 (acpP1)    00074 Mycolic acid biosynthesis     CLAM6_08930 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLAM6_08930 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 HLH Fas_alpha_ACP Motif Other DBs NCBI-ProteinID:  BBO55582 UniProt:  A0A5K7Y7V4 LinkDB All DBs Position 1069827..1070060 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNAKEEEIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYIVNHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccattgaagaacgcgtcaagaaggttgtggctgagcgcctgaacgccaaagaa gaagaaatccagaactcttcctctttcactgaagacctgggcgccgattccctggacacc gtcgagctggtgatggctcttgaagaggaattcgatactgaaattcctgacgaagaagca gagaagatcaccaccgtgcaggaagctatcgattacatcgtcaaccaccagtaa

DBGET integrated database retrieval system