Cobetia sp. AM6: CLAM6_14480 Help Entry CLAM6_14480       CDS       T08724                                  Name (GenBank) sarcosine oxidase subunit delta   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism cobe  Cobetia sp. AM6 Pathway cobe00260   Glycine, serine and threonine metabolism cobe01100   Metabolic pathways Module cobe_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:cobe00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     CLAM6_14480 Enzymes [BR:cobe01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      CLAM6_14480     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      CLAM6_14480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD FBA_1 Motif Other DBs NCBI-ProteinID:  BBO56137 UniProt:  A0A5K7Y634 LinkDB All DBs Position complement(1734132..1734443) Genome browser AA seq 103 aa AA seqDB search MKIMPCPLNGPRNISEFVYGGELADMPDPDTCSDREWADYVFFSDNTAGVVTEWWMHAAS SYWFLAERHTVTDEILRTFDPSERFTQRVEFPLHTTDSSGERA NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaagatcatgccctgcccactcaatgggccccgaaatatcagcgaattcgtgtatggc ggcgagcttgccgacatgccagaccccgatacctgcagtgatcgcgagtgggccgactac gtcttcttcagcgacaacaccgccggtgtcgtcaccgaatggtggatgcacgcggcctcc agctactggttcctcgccgagcgtcacaccgtgaccgacgagatcctgcgcaccttcgac ccctccgagcgcttcacccagcgcgtggagttcccactgcacaccacggatagctcggga gaacgcgcatga

DBGET integrated database retrieval system