Cobetia sp. AM6: CLAM6_18130 Help Entry CLAM6_18130       CDS       T08724                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism cobe  Cobetia sp. AM6 Pathway cobe02020   Two-component system cobe02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:cobe00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     CLAM6_18130  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     CLAM6_18130  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:cobe02035]     CLAM6_18130 Bacterial motility proteins [BR:cobe02035]  Flagellar system   Flagellar assembly proteins    Others     CLAM6_18130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  BBO56502 UniProt:  A0A5K7YA75 LinkDB All DBs Position 2162209..2162487 Genome browser AA seq 92 aa AA seqDB search MKIEHGGPIQRSDTQAPRELRPETAKDTTATTAATSTADSTQVELSSSAIDASQDIDQAR VDSLKQAIADGSIKIDVDRIAQGLIDAFEGDA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagattgaacatggcggcccgatacagcgcagcgacactcaagccccgcgcgaactg cgccccgagacggccaaggacaccaccgccactacggcggcgacctccacggccgactcc actcaggtcgagctttccagcagcgcgatcgatgcgagccaggacatcgaccaggcgcgc gtcgacagcctcaagcaagccatcgccgatggcagcatcaagatcgatgtcgaccgcatc gcacaagggctgatcgatgccttcgaaggtgacgcatga

DBGET integrated database retrieval system