Cobetia sp. AM6: CLAM6_20070 Help Entry CLAM6_20070       CDS       T08724                                  Symbol atpE_1 Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism cobe  Cobetia sp. AM6 Pathway cobe00190   Oxidative phosphorylation cobe01100   Metabolic pathways Module cobe_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cobe00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CLAM6_20070 (atpE_1)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cobe00194]     CLAM6_20070 (atpE_1) Photosynthesis proteins [BR:cobe00194]  Photosystem and electron transport system   F-type ATPase [OT]    CLAM6_20070 (atpE_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  BBO56696 LinkDB All DBs Position 2384992..2385237 Genome browser AA seq 81 aa AA seqDB search MDLIAFASIIGAAFAVAFGAIGPALAEGRAVAAAMDAIARQPEAANTISRTLFVGLAMIE TTAIYCLVISLLLLFANPLLG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggacctgatagctttcgccagcatcatcggggcagcgtttgccgtggccttcggtgcc attggccctgccctcgccgagggacgcgccgtcgccgcggcaatggatgccatcgctcgc cagcccgaggctgccaacaccatctcgcgcacgttgttcgtcggtctggccatgatcgag acgaccgccatctactgtctggtcatctcgttgctgctgctgttcgccaaccccttgctg ggatga

DBGET integrated database retrieval system