Cobetia sp. AM6: CLAM6_27210 Help Entry CLAM6_27210       CDS       T08724                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism cobe  Cobetia sp. AM6 Brite KEGG Orthology (KO) [BR:cobe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cobe03110]     CLAM6_27210 (groS)    03029 Mitochondrial biogenesis [BR:cobe03029]     CLAM6_27210 (groS) Chaperones and folding catalysts [BR:cobe03110]  Heat shock proteins   HSP10    CLAM6_27210 (groS) Mitochondrial biogenesis [BR:cobe03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     CLAM6_27210 (groS) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  BBO57410 LinkDB All DBs Position 3253366..3253659 Genome browser AA seq 97 aa AA seqDB search MNIRPLHDRVVVRRVEEEQKTAGGIVLPGSAQEKPTRGEILAAGNGRILENGEVRPLDVK VGDTVIFKDGYGVEKQKIDGEEVLIMSESDILAVVEG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaacattcgtcccttgcacgatcgcgtcgtggttcgtcgcgtggaagaagaacagaaa actgcaggtggcatcgttctgcccggcagcgcccaggaaaagccgacccgtggcgagatt ctcgccgccggtaacggtcgcatcctcgaaaacggtgaagttcgcccgctggacgtgaaa gtcggcgataccgtgatcttcaaggatggctacggcgtcgagaagcagaaaatcgacggc gaagaggtgctgatcatgagcgagagcgacatcctcgccgtggtagaaggctga

DBGET integrated database retrieval system