Cobetia sp. AM6: CLAM6_27380 Help Entry CLAM6_27380       CDS       T08724                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism cobe  Cobetia sp. AM6 Pathway cobe01100   Metabolic pathways cobe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cobe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLAM6_27380    00074 Mycolic acid biosynthesis     CLAM6_27380   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLAM6_27380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBO57427 UniProt:  A0A5K7Y9C5 LinkDB All DBs Position 3275856..3276125 Genome browser AA seq 89 aa AA seqDB search MSDSAKLELELKQLIIDTLELEDITPDDIVADEPLFVDGLGLDSIDALELGLALQKQYGI TLDAEAEDTRAHFASLNALRELVEARRER NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgatagcgccaagctggaactggaactcaagcaactgatcatcgataccctggag cttgaggacatcacgccggacgacatcgtcgccgatgagccgctgttcgtggacggcctg gggctggattcgattgacgccctggaactcggcctcgcgctgcagaagcagtacggcatc acgctggacgccgaagccgaggacactcgcgcgcatttcgccagcctcaatgccctgcgt gaactcgtggaggcccgtcgtgagcgctga

DBGET integrated database retrieval system