Cobetia sp. AM6: CLAM6_27390 Help Entry CLAM6_27390       CDS       T08724                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cobe  Cobetia sp. AM6 Pathway cobe01100   Metabolic pathways cobe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cobe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLAM6_27390 (acpP)    00074 Mycolic acid biosynthesis     CLAM6_27390 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLAM6_27390 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  BBO57428 UniProt:  A0A5K7Y8Q5 LinkDB All DBs Position 3276115..3276387 Genome browser AA seq 90 aa AA seqDB search MSAEQQTASREEIYAHVRSTLIELFEIDAADIHPEALLYEDLDIDSIDAVDLVVELKKFT GRRIEANDFKSVRSLDDVVTAVEQLMQRQA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgagcgctgagcaacagaccgcgtcccgcgaagagatctatgcccatgtgcgcagcact ctgatcgagctgttcgagatcgatgccgctgacatccaccctgaggcgctgctctatgaa gacctcgacatcgacagcatcgatgcggtggacctggtggtcgaactcaagaagttcacc ggccgccgcatcgaagccaatgacttcaagagcgtacgcagcctcgatgatgtcgtgacc gccgtcgagcagctgatgcagcgccaggcatga

DBGET integrated database retrieval system