Cobetia sp. AM6: CLAM6_28250 Help Entry CLAM6_28250       CDS       T08724                                  Symbol ppiC1 Name (GenBank) peptidylprolyl isomerase   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism cobe  Cobetia sp. AM6 Brite KEGG Orthology (KO) [BR:cobe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cobe03110]     CLAM6_28250 (ppiC1) Enzymes [BR:cobe01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      CLAM6_28250 (ppiC1) Chaperones and folding catalysts [BR:cobe03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     CLAM6_28250 (ppiC1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase Rotamase_3 Rotamase_2 RecR_HhH Motif Other DBs NCBI-ProteinID:  BBO57514 UniProt:  A0A5K7Y6B9 LinkDB All DBs Position complement(3379005..3379286) Genome browser AA seq 93 aa AA seqDB search MARIAMARHILVKTEAEAQRLKQSLERGQPFEKLAKKHSTCPSGKQGGDLGEVRPGQMVG GIDRAIFKGPLNTLQGPLKSKFGYHLLEVFFRG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctcgtattgccatggcacgccacattctggtgaagaccgaggccgaggcgcagcgt ctcaagcagtcactggagcgcggccagccgttcgagaaactggcgaaaaagcactccacc tgtccctccggcaagcagggcggtgacctgggcgaagtgcgccccggccagatggtcggc ggcattgatcgcgccatcttcaaggggccgctcaataccctgcaggggccgctgaagagc aagttcggctatcacctgctggaagtcttcttccgcggctga

DBGET integrated database retrieval system