Cardiocondyla obscurior: 139101888 Help Entry 139101888         CDS       T10704                                  Symbol Rac1 Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cobs  Cardiocondyla obscurior Pathway cobs04013   MAPK signaling pathway - fly cobs04145   Phagosome cobs04148   Efferocytosis cobs04310   Wnt signaling pathway cobs04620   Toll-like receptor signaling pathway cobs05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cobs00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     139101888 (Rac1)    04310 Wnt signaling pathway     139101888 (Rac1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     139101888 (Rac1)    04148 Efferocytosis     139101888 (Rac1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     139101888 (Rac1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     139101888 (Rac1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cobs04131]     139101888 (Rac1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cobs04147]     139101888 (Rac1)    04031 GTP-binding proteins [BR:cobs04031]     139101888 (Rac1) Membrane trafficking [BR:cobs04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     139101888 (Rac1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     139101888 (Rac1)   Macropinocytosis    Ras GTPases     139101888 (Rac1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     139101888 (Rac1) Exosome [BR:cobs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    139101888 (Rac1)   Exosomal proteins of other body fluids (saliva and urine)    139101888 (Rac1)   Exosomal proteins of colorectal cancer cells    139101888 (Rac1)   Exosomal proteins of bladder cancer cells    139101888 (Rac1) GTP-binding proteins [BR:cobs04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     139101888 (Rac1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  139101888 NCBI-ProteinID:  XP_070511499 LinkDB All DBs Position LG04:complement(1549941..1551646) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV MQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaagtgcgtggtcgtcggcgatggtgccgtgggtaaaacatgcttgttg ataagctacaccaccaatgcttttcctggagaatacattccgacggtattcgacaattac tcggcgaatgtgatggtagatgggaaaccgatcaatctcggcctgtgggacacagcaggg caggaggattacgacagactgcggccgctgtcgtatccacaaaccgatgtttttctaatt tgcttttccttggtaaacccggcgagttttgagaacgtgcgtgccaaatggtatccagag gtacgtcaccactgtccatccactccgatcatcctagttggcactaagcttgatctacgc gaggataaggaaaccattgagcgtttgaaagacaaaaagctagctcccattacttaccct cagggtttagcgatggcaaaggaaatcggagctgtcaaatatttggaatgctctgccttg acgcagaaaggcttgaagactgtatttgacgaggcaatacgcgccgtgctgtgccctgtt atgcaagtgaagccaaagcgcagatgtttccttctataa

DBGET integrated database retrieval system