Cardiocondyla obscurior: 139105412 Help Entry 139105412         CDS       T10704                                  Symbol Ubl Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism cobs  Cardiocondyla obscurior Brite KEGG Orthology (KO) [BR:cobs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:cobs03041]     139105412 (Ubl)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cobs04052]     139105412 (Ubl) Spliceosome [BR:cobs03041]  Complex B   Other components    Complex B specific factors     139105412 (Ubl) Cytokines and neuropeptides [BR:cobs04052]  Neuropeptides   Unclassified    139105412 (Ubl) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler OTU1_UBXL Motif Other DBs NCBI-GeneID:  139105412 NCBI-ProteinID:  XP_070517600 LinkDB All DBs Position LG09:5248119..5250154 Genome browser AA seq 73 aa AA seqDB search MLEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTHWEKIVLKKWYTIFKDHIKLQDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgttagagataacgtgcaacgaccgtcttggtaaaaaggtcagagtaaagtgcaatcca gacgacactattggagacctgaagaaattgatagctgcccagactggtacacattgggag aaaattgtactgaagaagtggtacaccattttcaaagatcacataaagctgcaagactat gaaatacatgatggcatgaacctagaactctattaccaataa

DBGET integrated database retrieval system