Cardiocondyla obscurior: 139106974 Help Entry 139106974         CDS       T10704                                  Symbol Rab7 Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism cobs  Cardiocondyla obscurior Pathway cobs04137   Mitophagy - animal cobs04140   Autophagy - animal cobs04144   Endocytosis cobs04145   Phagosome cobs04148   Efferocytosis Brite KEGG Orthology (KO) [BR:cobs00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     139106974 (Rab7)    04145 Phagosome     139106974 (Rab7)    04140 Autophagy - animal     139106974 (Rab7)    04137 Mitophagy - animal     139106974 (Rab7)    04148 Efferocytosis     139106974 (Rab7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cobs04131]     139106974 (Rab7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cobs04147]     139106974 (Rab7)    04031 GTP-binding proteins [BR:cobs04031]     139106974 (Rab7) Membrane trafficking [BR:cobs04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     139106974 (Rab7) Exosome [BR:cobs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    139106974 (Rab7)   Exosomal proteins of other body fluids (saliva and urine)    139106974 (Rab7)   Exosomal proteins of colorectal cancer cells    139106974 (Rab7)   Exosomal proteins of bladder cancer cells    139106974 (Rab7) GTP-binding proteins [BR:cobs04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     139106974 (Rab7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin AAA_16 PduV-EutP AAA_7 AAA_22 NTPase_1 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  139106974 NCBI-ProteinID:  XP_070520229 LinkDB All DBs Position LG12:complement(3465871..3470778) Genome browser AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVEDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVSAPTSFKSLDSWRDEFLIQASPRDPDNFPF VVLGNKVDLESRAVSSKRAQQWCQSKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRSNGRGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgtctcgcaagaaagtactgctgaaagtgattatccttggggattcgggagttgga aaaacttctttgatgaaccagtatgtcaataagaagtttagtaaccaatacaaagcgaca ataggagcagattttttgaccaaggaagtgatggtggaggatagaatagtcactatgcag atttgggacaccgccgggcaggaaaggtttcaatcattaggagtggctttctacagaggc gcagactgttgcgtgttggtatttgatgtgtctgctccaactagcttcaaatccttagat tcatggagggatgaatttttaattcaagcgtcgcctcgagatccggacaactttccgttt gtcgtgctcgggaataaagtagatcttgaatcaagagcggtctcaagcaagagagcacaa cagtggtgtcaatcaaagaacaatattccatatttcgaaactagtgcaaaagaggctatt aatgtcgagcaagctttccaaacgatagctaaaaacgctttagctcaagaaagtgaagtg gaactttacaatgaattcccggatcaaatcaaattgaccaatgaccaaagaagcaacggc agaggtgattcatgtgcttgctag

DBGET integrated database retrieval system