Cardiocondyla obscurior: 139111477 Help Entry 139111477         CDS       T10704                                  Symbol Urm1 Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism cobs  Cardiocondyla obscurior Pathway cobs04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:cobs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     139111477 (Urm1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:cobs03016]     139111477 (Urm1)    04121 Ubiquitin system [BR:cobs04121]     139111477 (Urm1) Transfer RNA biogenesis [BR:cobs03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     139111477 (Urm1) Ubiquitin system [BR:cobs04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    139111477 (Urm1) SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  139111477 NCBI-ProteinID:  XP_070527884 LinkDB All DBs AA seq 100 aa AA seqDB search MTAAVLPLTIEFGGGAELLFEGKKRHEVDLPGVEWTLRQLLHWLRDNLLTERPELFIQDD TVRPGILVLVNDADWELLGEGDYKLNPRDRVLFISTLHGG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgacggcggccgtgttacctctcacaatcgagttcgggggtggggcagagctgctgttc gaggggaagaagcggcacgaggtggacttacctggcgtggagtggacgctgagacaactg ctgcactggctgcgagataacctcttgaccgagcggccggaacttttcatccaggacgac acggtgagaccaggcatcttggttctagtgaacgatgccgattgggaattgttgggtgaa ggcgattataaactaaatccacgggacagggtgctctttatctcgacgttgcacggagga taa

DBGET integrated database retrieval system