Comamonas odontotermitis: LAD35_03120 Help Entry LAD35_03120       CDS       T07833                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism codo  Comamonas odontotermitis Brite KEGG Orthology (KO) [BR:codo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:codo03036]     LAD35_03120 (ftsL) Chromosome and associated proteins [BR:codo03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LAD35_03120 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  UBB18981 LinkDB All DBs Position 689484..689765 Genome browser AA seq 93 aa AA seqDB search MLRLNILLLILSILSAMALVQSQYEARKLFTELDRTVAQSRQLETDHQRLQVEKRAQATP LRLEQLARDKMGMQTATPAVTVYVPEPGVGAAQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt ctgctgcgcctgaatatccttttgctgattctgtcgatcctcagcgccatggcgctggtg cagtcacagtatgaagcgcgcaagctgttcaccgagctggaccgcacggtggcgcagtcg cgccagttggaaaccgaccaccagcgcctgcaggtggaaaagcgtgcccaggccacgccg ctgcgcctggagcagttggcgcgcgacaagatgggaatgcagacggcaacgcctgcggtg actgtgtatgtgcccgagcctggcgtgggagctgcgcaatga

DBGET integrated database retrieval system