Comamonas odontotermitis: LAD35_04225 Help Entry LAD35_04225       CDS       T07833                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism codo  Comamonas odontotermitis Brite KEGG Orthology (KO) [BR:codo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:codo03110]     LAD35_04225 (grxC) Chaperones and folding catalysts [BR:codo03110]  Protein folding catalysts   Protein disulfide isomerase    LAD35_04225 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 DSBA DUF5880 Motif Other DBs NCBI-ProteinID:  UBB17863 LinkDB All DBs Position 908020..908277 Genome browser AA seq 85 aa AA seqDB search MQAVKMYTTAVCPYCIRAKQVLKSKGVENIEEIRIDTDPAQREVMMQVTGRRTVPQIFIG DTHVGGCDDLIALDQRGGLMPLLGA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagccgtcaagatgtataccaccgccgtctgcccctattgcattcgtgccaagcag gtgctcaagtccaagggcgtggagaacattgaagaaatccgcatcgacaccgatcccgcg cagcgcgaggtgatgatgcaggtcacgggccgtcgcacagtgccgcagatcttcattggc gacacccatgtgggcggatgtgatgacctgattgcgctggaccagcggggcgggctgatg ccgctgctgggcgcctga

DBGET integrated database retrieval system