Comamonas flocculans: FOZ74_05115 Help Entry FOZ74_05115       CDS       T06146                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism cof  Comamonas flocculans Pathway cof00190   Oxidative phosphorylation cof01100   Metabolic pathways Module cof_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:cof00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FOZ74_05115 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:cof00194]     FOZ74_05115 (atpE) Photosynthesis proteins [BR:cof00194]  Photosystem and electron transport system   F-type ATPase [OT]    FOZ74_05115 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Romo1 Motif Other DBs NCBI-ProteinID:  QEA12459 UniProt:  A0A5B8RS28 LinkDB All DBs Position complement(1045052..1045315) Genome browser AA seq 87 aa AA seqDB search MEVISFVALAAGLIIGLGAVGACIGIGLMGSKFLESAARQPELMGELQTKMFLLVGLIDA AFIIGVGIALWFATANPFLGQIALIAK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggaagttatcagctttgttgccctggccgccggcctgatcattggtctgggcgccgtc ggtgcgtgtatcggcatcggcctcatgggcagcaagttcctcgagtcggccgctcgccag cccgagctgatgggcgaactgcaaaccaagatgttcctgttggtcggtctgatcgacgcg gccttcatcatcggcgtgggtatcgcgctgtggttcgccacggccaaccccttcctgggt cagatcgccctgatcgccaagtaa

DBGET integrated database retrieval system