Comamonas flocculans: FOZ74_08260 Help Entry FOZ74_08260       CDS       T06146                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism cof  Comamonas flocculans Pathway cof00361   Chlorocyclohexane and chlorobenzene degradation cof00362   Benzoate degradation cof00623   Toluene degradation cof01100   Metabolic pathways cof01120   Microbial metabolism in diverse environments cof01220   Degradation of aromatic compounds Module cof_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:cof00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     FOZ74_08260    00361 Chlorocyclohexane and chlorobenzene degradation     FOZ74_08260    00623 Toluene degradation     FOZ74_08260 Enzymes [BR:cof01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      FOZ74_08260     1.14.13.244  phenol 2-monooxygenase (NADH)      FOZ74_08260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  QEA13023 UniProt:  A0A5B8RV77 LinkDB All DBs Position 1700431..1700709 Genome browser AA seq 92 aa AA seqDB search MTQVPNVFIALQRNEETRPIVDAILADNPGALLDEQPAMVKINVPGRLVVRRSTIEQEIG RDFDLQELHVNLITLTGHIDESDDEFVLSWVH NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgacccaagtacccaacgtcttcatcgcgctgcagcgcaatgaggaaacccgcccgatc gtcgatgcgatcctggcggacaaccccggcgccctgctcgacgagcagccggccatggtc aagatcaacgtgcccgggcgcctggtggtgcgccgcagcaccatcgagcaggagatcggg cgcgacttcgacctgcaggagctgcacgtgaacctgatcacgctgaccggccacatcgat gaatccgacgacgagttcgtgctgagctgggtgcactga

DBGET integrated database retrieval system