Cohnella candidum: EAV92_04825 Help Entry EAV92_04825       CDS       T05696                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism coh  Cohnella candidum Pathway coh00998   Biosynthesis of various antibiotics coh01100   Metabolic pathways coh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:coh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EAV92_04825    00074 Mycolic acid biosynthesis     EAV92_04825   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EAV92_04825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AYQ71946 UniProt:  A0A3G3JUP0 LinkDB All DBs Position 1045772..1046005 Genome browser AA seq 77 aa AA seqDB search MSDVYDRVKRIVVERLGVEEAEVTAEASFKDDLGADSLDVVELVMELEDEFDLEISDEDA EKITTVGEVVNYIQSHS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtccgatgtttatgatcgcgtgaaacgcatcgtcgtcgaacgcctgggagtggaagag gcggaagttaccgccgaagcatccttcaaagacgacttgggcgctgactctctcgacgtg gtagaactcgtgatggagctcgaagacgaattcgacttggagatctccgacgaggatgca gagaagatcacaacggtgggagaagtcgtaaattacatacaatctcattcgtaa

DBGET integrated database retrieval system