Cohnella candidum: EAV92_06480 Help Entry EAV92_06480       CDS       T05696                                  Name (GenBank) spore coat protein   KO K06440   similar to spore coat protein Organism coh  Cohnella candidum Brite KEGG Orthology (KO) [BR:coh00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     EAV92_06480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glycolytic Motif Other DBs NCBI-ProteinID:  AYQ72244 UniProt:  A0A3G3JVN8 LinkDB All DBs Position 1379240..1379449 Genome browser AA seq 69 aa AA seqDB search MDETLRMAPHETMEVHEMVNFKTLCLAQSKLMQGIVFDRDLKHLMQKDVEVTMRHLDQLK GLYAKIRLQ NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtggatgaaactttgcgcatggcgccccacgagacaatggaagtgcatgaaatggtcaat ttcaaaacgctgtgcctggcgcagtccaaattgatgcagggaatcgttttcgacagggac ctgaagcacctgatgcaaaaagacgtggaagtgacgatgcgtcacctggatcaactcaaa ggcttgtacgcgaaaataaggctgcagtaa

DBGET integrated database retrieval system