Cohnella candidum: EAV92_19810 Help Entry EAV92_19810       CDS       T05696                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism coh  Cohnella candidum Brite KEGG Orthology (KO) [BR:coh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:coh03032]     EAV92_19810    03036 Chromosome and associated proteins [BR:coh03036]     EAV92_19810    03400 DNA repair and recombination proteins [BR:coh03400]     EAV92_19810 DNA replication proteins [BR:coh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EAV92_19810 Chromosome and associated proteins [BR:coh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EAV92_19810 DNA repair and recombination proteins [BR:coh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EAV92_19810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AYQ74616 UniProt:  A0A3G3K286 LinkDB All DBs Position 4293668..4293943 Genome browser AA seq 91 aa AA seqDB search MANKTDLINNIATKTGLTKKDVESVLNGFLGEVETALAAGDKVQLIGFGTFETRSRSGRV GRNPQTGKSIEIPASKVPAFKAGNKLKDAVK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcaaacaaaaccgacctgatcaacaacatcgcgactaaaacgggcttgaccaaaaaa gacgtcgaatccgtactgaacggcttcctgggcgaagttgaaaccgctctggctgcaggc gacaaagttcaactcatcggcttcggcacgttcgaaacccgctcccgttccggccgcgta ggccgcaacccgcaaacgggcaaatcgatcgaaatcccggcttccaaagttccggctttc aaagcaggcaacaaactgaaagacgccgtaaagtaa

DBGET integrated database retrieval system